PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG556300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GATA
Protein Properties Length: 299aa    MW: 33936.7 Da    PI: 9.2657
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG556300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA38.41.8e-12147179133
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                          CsnC + +Tp WR+gp+g  +LCnaCGl+ +++
  Pavir.3KG556300.1.p 147 CSNCLSCETPRWRNGPSGIQMLCNACGLRLKSE 179
                          *****************************9987 PP

2GATA529.3e-17229263135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++C ++ Tp+WR+gp g+ tLCnaCG+++++ +l
  Pavir.3KG556300.1.p 229 CTHCMSSRTPQWRSGPFGPMTLCNACGVRFKSGRL 263
                          *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.927141195IPR000679Zinc finger, GATA-type
SMARTSM004016.8E-10141192IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.4E-13143187IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577167.6E-11144183No hitNo description
CDDcd002029.77E-11146178No hitNo description
PfamPF003202.2E-10147179IPR000679Zinc finger, GATA-type
PROSITE patternPS003440147172IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.503223259IPR000679Zinc finger, GATA-type
SMARTSM004015.4E-14223277IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-14224286No hitNo description
Gene3DG3DSA:3.30.50.108.1E-13227261IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.64E-12228275No hitNo description
PfamPF003206.6E-15229263IPR000679Zinc finger, GATA-type
PROSITE patternPS003440229254IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MDVHPANATP DSLGDLFPHQ AAALERLFSN STSYTNPSFA IPAPTISNEG AGKPKLPPPS  60
SSNGRRKKRS LASVMGNDDD QQYIIPLYVE PPLLLIDQKH WMAESELILP KKEEQKVCQQ  120
QEQEQEEEKC QKGVLVQFRQ ERLVKRCSNC LSCETPRWRN GPSGIQMLCN ACGLRLKSEN  180
RFATISEEHY GQETKKEQEP GKRQDKKKKM IKKTYVSEEL SSDKQEKRCT HCMSSRTPQW  240
RSGPFGPMTL CNACGVRFKS GRLLPEYRPA NSPTFVSFLH SYSHKKVMQM RQAIAYKE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201208KRQDKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963249.11e-163PREDICTED: GATA transcription factor 2-like
TrEMBLK3Z8571e-163K3Z857_SETIT; Uncharacterized protein
STRINGSi022727m1e-163(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.17e-32GATA transcription factor 4